UTP14C Peptide - C-terminal region
UTP14C Peptide - C-terminal region
Product Specifications
Product Name Alternative
2700066J21Rik, KIAA0266, UTP14B
UniProt
Q5TAP6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UTP14C Rabbit Polyclonal Antibody (orb326696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067677
Preservative
Lyophilized powder
AA Sequence
EAFAGDDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1075026-01 100 mg
2,2'- (3-Phenylpropane-1,1-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
Sign In for Pricing
View Details OR1075026-02 250 mg
2,2'- (3-Phenylpropane-1,1-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
Sign In for Pricing
View Details OR1075026-03 1 g
2,2'- (3-Phenylpropane-1,1-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
Sign In for Pricing
View Details OR1075026-04 5 g
2,2'- (3-Phenylpropane-1,1-diyl) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
Sign In for Pricing
View Details 