Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP14C Peptide - C-terminal region

UTP14C Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700066J21Rik, KIAA0266, UTP14B

UniProt

Q5TAP6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTP14C Rabbit Polyclonal Antibody (orb326696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067677

Preservative

Lyophilized powder

AA Sequence

EAFAGDDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydroepiandrosterone (DHEA) CLIA Kit
EKN50568 96 Tests

Dehydroepiandrosterone (DHEA) CLIA Kit

Sign In for Pricing
View Details
NOV Protein Lysate
OCOA00808-20UG 20 µg

NOV Protein Lysate

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein gD (HSVI) (MaxLight 650)
MBS6264871-01 0.1 mL

Herpes Simplex Virus I, Glycoprotein gD (HSVI) (MaxLight 650)

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein gD (HSVI) (MaxLight 650)
MBS6264871-02 5x 0.1 mL

Herpes Simplex Virus I, Glycoprotein gD (HSVI) (MaxLight 650)

Sign In for Pricing
View Details
Goat anti-Transcription factor E2F1 (aa314-327) Antibody
dAP-2975 50 µg

Goat anti-Transcription factor E2F1 (aa314-327) Antibody

Sign In for Pricing
View Details
Guinea Pig Calsyntenin 1 (CLSTN1) ELISA Kit
GTR10338447 96 Well

Guinea Pig Calsyntenin 1 (CLSTN1) ELISA Kit

Sign In for Pricing
View Details