Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YARS2 Peptide - C-terminal region

YARS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MLASA2, MT-TYRRS, TYRRS

UniProt

Q9Y2Z4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YARS2 Rabbit Polyclonal Antibody (orb586910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035526

Preservative

Lyophilized powder

AA Sequence

QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAS1L Antibody
KC-3137-01 50 μL

LAS1L Antibody

Sign In for Pricing
View Details
LAS1L Antibody
KC-3137-02 100 µL

LAS1L Antibody

Sign In for Pricing
View Details
LAS1L Antibody
KC-3137-03 1 mL

LAS1L Antibody

Sign In for Pricing
View Details
Moesin (MSN/491), 0.2mg/mL
BNUB0491-100 1x 100 µL

Moesin (MSN/491), 0.2mg/mL

Sign In for Pricing
View Details
Coprs Mouse Gene Knockout Kit (CRISPR)
KN503681 1 Kit

Coprs Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wdr11 Mouse Gene Knockout Kit (CRISPR)
KN519336 1 Kit

Wdr11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details