Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YARS2 Peptide - C-terminal region

YARS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MLASA2, MT-TYRRS, TYRRS

UniProt

Q9Y2Z4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YARS2 Rabbit Polyclonal Antibody (orb586910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035526

Preservative

Lyophilized powder

AA Sequence

QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 (NM_001197124) Human Over-expression Lysate
LY434143 100 µg

IRF3 (NM_001197124) Human Over-expression Lysate

Sign In for Pricing
View Details
NANOG (1-154) Mouse Monoclonal Antibody [Clone ID: 5A10]
AM09023PU-S 50 µL

NANOG (1-154) Mouse Monoclonal Antibody [Clone ID: 5A10]

Sign In for Pricing
View Details
Mid1ip1 (NM_026524) Mouse Tagged ORF Clone
MG201647 10 µg

Mid1ip1 (NM_026524) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG2b*
V100175-AAT 50 µg

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG2b*

Sign In for Pricing
View Details
FHAD1 (C-term) Rabbit Polyclonal Antibody
AP51667PU-N 400 µL

FHAD1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYNPO2 Polyclonal Antibody
E-AB-16895-01 20 µL

SYNPO2 Polyclonal Antibody

Sign In for Pricing
View Details