Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YTHDF2 Peptide - C-terminal region

YTHDF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HGRG8, NY-REN-2

UniProt

Q9Y5A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YTHDF2 Rabbit Polyclonal Antibody (orb586915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057342

Preservative

Lyophilized powder

AA Sequence

WSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroguanylin (GUCA2B) (NM_007102) Human Over-expression Lysate
LS002981-20ug 20 µg

Uroguanylin (GUCA2B) (NM_007102) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit
DLR-ARHGEF7-Hu-48T 48 Tests

Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) ELISA Kit

Sign In for Pricing
View Details
SGPP1 Antibody
GWB-MR728H 50 µg

SGPP1 Antibody

Sign In for Pricing
View Details
NPM1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1446805 3x 1.0 µg

NPM1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PLCZ1 siRNA (Rat)
orb1827442-01 15 nmol

PLCZ1 siRNA (Rat)

Sign In for Pricing
View Details
PLCZ1 siRNA (Rat)
orb1827442-02 30 nmol

PLCZ1 siRNA (Rat)

Sign In for Pricing
View Details