Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YTHDF2 Peptide - C-terminal region

YTHDF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HGRG8, NY-REN-2

UniProt

Q9Y5A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YTHDF2 Rabbit Polyclonal Antibody (orb586915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057342

Preservative

Lyophilized powder

AA Sequence

WSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1309730 (NM_001106491) Rat Tagged ORF Clone
RR215146 10 µg

RGD1309730 (NM_001106491) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human HOMEZ Knockout A549 cell line
GTR15413004 1 Vial

Human HOMEZ Knockout A549 cell line

Sign In for Pricing
View Details
Histidyl-tRNA Synthetase (HARS) Antibody
30049-05111 150 µg

Histidyl-tRNA Synthetase (HARS) Antibody

Sign In for Pricing
View Details
ADAMTS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
11359066 1.0 µg DNA

ADAMTS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
9-Benzylcarbazole-3-carboxaldehyde
sc-484677 1 g

9-Benzylcarbazole-3-carboxaldehyde

Sign In for Pricing
View Details
Cardiac Troponin T Recombinant Monoclonal Antibody
RAA00271-01 100 µL

Cardiac Troponin T Recombinant Monoclonal Antibody

Sign In for Pricing
View Details