Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOXL Peptide - C-terminal region

ACOXL Peptide - C-terminal region

Product Specifications

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOXL Rabbit Polyclonal Antibody (orb326699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136280

Preservative

Lyophilized powder

AA Sequence

SRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFVSRYAGALLDEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD299 Rabbit Polyclonal Antibody (BF488)
orb2555046 100 µL

CD299 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
DIO2 (NM_001242502) Human Tagged ORF Clone
RG231826 10 µg

DIO2 (NM_001242502) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal PIST Antibody [Janelia Fluor 646]
NBP1-77242JF646 0.1 mL

Rabbit Polyclonal PIST Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
VWF Rabbit mAb
E60M2017 100 µL

VWF Rabbit mAb

Sign In for Pricing
View Details
CD8a (T-cell Surface Glycoprotein CD8 alpha Chain, T-cell Surface Glycoprotein Lyt-2, Lyt-2, Lyt2, CD8 Antigen, alpha Chain, BB154331, Ly-B)
C2259-22G-01 50 µg

CD8a (T-cell Surface Glycoprotein CD8 alpha Chain, T-cell Surface Glycoprotein Lyt-2, Lyt-2, Lyt2, CD8 Antigen, alpha Chain, BB154331, Ly-B)

Sign In for Pricing
View Details
CD8a (T-cell Surface Glycoprotein CD8 alpha Chain, T-cell Surface Glycoprotein Lyt-2, Lyt-2, Lyt2, CD8 Antigen, alpha Chain, BB154331, Ly-B)
C2259-22G-02 500 µg

CD8a (T-cell Surface Glycoprotein CD8 alpha Chain, T-cell Surface Glycoprotein Lyt-2, Lyt-2, Lyt2, CD8 Antigen, alpha Chain, BB154331, Ly-B)

Sign In for Pricing
View Details