Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOXL Peptide - C-terminal region

ACOXL Peptide - C-terminal region

Product Specifications

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOXL Rabbit Polyclonal Antibody (orb326699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136280

Preservative

Lyophilized powder

AA Sequence

SRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFVSRYAGALLDEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NIRF/UHRF2 Antibody Picoband® (Carrier-free Conjugate)
PB9906-carrier-free 100 µg/Vial

Anti-NIRF/UHRF2 Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Anti-SLC9A7 Antibody FITC Conjugated
A11831-2-FITC 100 µg/Vial

Anti-SLC9A7 Antibody FITC Conjugated

Sign In for Pricing
View Details
Anti-GRB7 Antibody Picoband®, HRP Conjugate
A02528-HRP 100 µg/Vial

Anti-GRB7 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Dbn1 3'UTR Luciferase Stable Cell Line
TU104863 1.0 mL

Dbn1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Nω-Nitro-L-arginine
461108-01 1 g

Nω-Nitro-L-arginine

Sign In for Pricing
View Details
Nω-Nitro-L-arginine
461108-02 5 g

Nω-Nitro-L-arginine

Sign In for Pricing
View Details