Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOXL Peptide - C-terminal region

ACOXL Peptide - C-terminal region

Product Specifications

UniProt

E9PB20

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOXL Rabbit Polyclonal Antibody (orb326700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136279

Preservative

Lyophilized powder

AA Sequence

AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFRalpha V561D Recombinant Human Active Protein Kinase
HY-E70764 1 Each

PDGFRalpha V561D Recombinant Human Active Protein Kinase

Sign In for Pricing
View Details
CD1C Antibody
orb1321385-01 30 µL

CD1C Antibody

Sign In for Pricing
View Details
CD1C Antibody
orb1321385-02 50 μL

CD1C Antibody

Sign In for Pricing
View Details
CD1C Antibody
orb1321385-03 100 µL

CD1C Antibody

Sign In for Pricing
View Details
Tray - CNT330/300/320
SD6506 1 Each

Tray - CNT330/300/320

Sign In for Pricing
View Details
Amlitelimab (Anti-TNFSF4 / OX40L / CD252)
C00531-01 1 mg

Amlitelimab (Anti-TNFSF4 / OX40L / CD252)

Sign In for Pricing
View Details