Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGFG2 Peptide - N-terminal region

AGFG2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRBL, RABR

UniProt

O95081

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGFG2 Rabbit Polyclonal Antibody (orb586924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006067

Preservative

Lyophilized powder

AA Sequence

NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gla activation kit by CRISPRa
GA200124 1 Kit

Mouse Gla activation kit by CRISPRa

Sign In for Pricing
View Details
16-Epiestriol, Ultra Pure (contains less than 0.3% Estriol)
TRC-E586501-25MG 25 mg

16-Epiestriol, Ultra Pure (contains less than 0.3% Estriol)

Sign In for Pricing
View Details
LTK (NM_002344) Human Recombinant Protein
TP700153 20 µg

LTK (NM_002344) Human Recombinant Protein

Sign In for Pricing
View Details
PPIL1 (Center) Rabbit Polyclonal Antibody
AP53412PU-N 400 µL

PPIL1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648692 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF568 conjugate, 0.1mg/mL
BNC681919-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details