Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B9D2 Peptide - N-terminal region

B9D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ICIS-1, MKS10, MKSR2

UniProt

Q9BPU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B9D2 Rabbit Polyclonal Antibody (orb586930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085055

Preservative

Lyophilized powder

AA Sequence

SESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C19orf38 shRNA (UAS) - Lentiviral human C19orf38 shRNA (UAS, iRFP) (100)
GTR15086991 1 Vial

Lentiviral human C19orf38 shRNA (UAS) - Lentiviral human C19orf38 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CPA4 Protein Vector (Rat) (pPB-C-His)
PV261426 500 ng

CPA4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Horse Vascular Endothelial Cell Growth Factor (VEGF) ELISA Kit
AE57186HO-01 48 Tests

Horse Vascular Endothelial Cell Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details
Horse Vascular Endothelial Cell Growth Factor (VEGF) ELISA Kit
AE57186HO-02 96 Tests

Horse Vascular Endothelial Cell Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details
LOC679977 3'UTR Luciferase Stable Cell Line
TU210527 1.0 mL

LOC679977 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FLRT3 Polyclonal Antibody, FITC Conjugated
bs-25263R-FITC 100 µL

FLRT3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details