Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B9D2 Peptide - N-terminal region

B9D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ICIS-1, MKS10, MKSR2

UniProt

Q9BPU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B9D2 Rabbit Polyclonal Antibody (orb586930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085055

Preservative

Lyophilized powder

AA Sequence

SESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR1A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1509R-BF350-TR 20 µL

BMPR1A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Mouse Alpha- (1,6) -Fucosyltransferase (FUT8) CLIA Kit
abx494816-01 96 Tests

Mouse Alpha- (1,6) -Fucosyltransferase (FUT8) CLIA Kit

Sign In for Pricing
View Details
Mouse Alpha- (1,6) -Fucosyltransferase (FUT8) CLIA Kit
abx494816-02 5x 96 Tests

Mouse Alpha- (1,6) -Fucosyltransferase (FUT8) CLIA Kit

Sign In for Pricing
View Details
Mouse Alpha- (1,6) -Fucosyltransferase (FUT8) CLIA Kit
abx494816-03 10x 96 Tests

Mouse Alpha- (1,6) -Fucosyltransferase (FUT8) CLIA Kit

Sign In for Pricing
View Details
Tenascin-C (E-9) : m-IgG Fc BP-HRP Bundle
sc-526650 1 Kit

Tenascin-C (E-9) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Mouse Cotinine (Cotinine) ELISA Kit
YLA1942MO-01 48 Tests

Mouse Cotinine (Cotinine) ELISA Kit

Sign In for Pricing
View Details