Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB6 Peptide - N-terminal region

BPIFB6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPIL3, LPLUNC6

UniProt

Q8NFQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFB6 Rabbit Polyclonal Antibody (orb326707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777557

Preservative

Lyophilized powder

AA Sequence

EKMAAEAGKKQPGMKPIKGITNLKVKDVQLPVITLNFVPGVGIFQCVSTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GNAO1 protein
orb419083-01 20 µg

Mouse GNAO1 protein

Sign In for Pricing
View Details
Mouse GNAO1 protein
orb419083-02 100 µg

Mouse GNAO1 protein

Sign In for Pricing
View Details
Mouse GNAO1 protein
orb419083-03 1 mg

Mouse GNAO1 protein

Sign In for Pricing
View Details
TCEB3 Protein Vector (Mouse) (pPB-N-His)
PV237019 500 ng

TCEB3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human Beta-Glucuronidase (GUSB) ELISA Kit
abx253723-01 96 Tests

Human Beta-Glucuronidase (GUSB) ELISA Kit

Sign In for Pricing
View Details
Human Beta-Glucuronidase (GUSB) ELISA Kit
abx253723-02 5x 96 Tests

Human Beta-Glucuronidase (GUSB) ELISA Kit

Sign In for Pricing
View Details