Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB6 Peptide - N-terminal region

BPIFB6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPIL3, LPLUNC6

UniProt

Q8NFQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFB6 Rabbit Polyclonal Antibody (orb326707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777557

Preservative

Lyophilized powder

AA Sequence

EKMAAEAGKKQPGMKPIKGITNLKVKDVQLPVITLNFVPGVGIFQCVSTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSP58 (m) -PR
sc-75839-PR 10 µM - 20 µL

MSP58 (m) -PR

Sign In for Pricing
View Details
Pigeon Krueppel-Like Factor 11 (KLF11) ELISA Kit
MBS9915481 Inquire

Pigeon Krueppel-Like Factor 11 (KLF11) ELISA Kit

Sign In for Pricing
View Details
TRIM27 CRISPR/Cas9 KO Plasmid (m)
sc-422660 20 µg

TRIM27 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
SLC17A5 Polyclonal Conjugated Antibody
MBS9440558-01 0.1 mL (Biotin)

SLC17A5 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SLC17A5 Polyclonal Conjugated Antibody
MBS9440558-02 0.1 mL (AF350)

SLC17A5 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SLC17A5 Polyclonal Conjugated Antibody
MBS9440558-03 0.1 mL (AF405)

SLC17A5 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details