Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD18 Peptide - C-terminal region

BTBD18 Peptide - C-terminal region

Product Specifications

UniProt

B2RXH4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD18 Rabbit Polyclonal Antibody (orb326709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138573

Preservative

Lyophilized powder

AA Sequence

IEGEEWCLPDMELWPRELTELEKEPAGENRGPTELLSPLVMPSEVSEVLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRG2 Recombinant Protein (Human)
RP009838 100 µg

DRG2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Goat Mouse IgE (Fc specific) Antibody
orb22159 1 mL

Goat Mouse IgE (Fc specific) Antibody

Sign In for Pricing
View Details
TMEM87A cDNA Clone
MBS1277827-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TMEM87A cDNA Clone

Sign In for Pricing
View Details
TMEM87A cDNA Clone
MBS1277827-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TMEM87A cDNA Clone

Sign In for Pricing
View Details
PEBP4 Antibody
KC-41772-01 50 μL

PEBP4 Antibody

Sign In for Pricing
View Details
PEBP4 Antibody
KC-41772-02 100 µL

PEBP4 Antibody

Sign In for Pricing
View Details