Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD18 Peptide - C-terminal region

BTBD18 Peptide - C-terminal region

Product Specifications

UniProt

B2RXH4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD18 Rabbit Polyclonal Antibody (orb326709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138573

Preservative

Lyophilized powder

AA Sequence

IEGEEWCLPDMELWPRELTELEKEPAGENRGPTELLSPLVMPSEVSEVLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV QP383R Protein, N-His
orb3152306-01 50 µg

Recombinant ASFV QP383R Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV QP383R Protein, N-His
orb3152306-02 100 µg

Recombinant ASFV QP383R Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV QP383R Protein, N-His
orb3152306-03 1 mg

Recombinant ASFV QP383R Protein, N-His

Sign In for Pricing
View Details
Human Protocadherin alpha-13, PCDHA13 ELISA Kit
MBS9322528-01 48 Well

Human Protocadherin alpha-13, PCDHA13 ELISA Kit

Sign In for Pricing
View Details
Human Protocadherin alpha-13, PCDHA13 ELISA Kit
MBS9322528-02 96 Well

Human Protocadherin alpha-13, PCDHA13 ELISA Kit

Sign In for Pricing
View Details
Human Protocadherin alpha-13, PCDHA13 ELISA Kit
MBS9322528-03 5x 96 Well

Human Protocadherin alpha-13, PCDHA13 ELISA Kit

Sign In for Pricing
View Details