Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTF3L4 Peptide - C-terminal region

BTF3L4 Peptide - C-terminal region

Product Specifications

UniProt

Q96K17

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTF3L4 Rabbit Polyclonal Antibody (orb586933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689478

Preservative

Lyophilized powder

AA Sequence

SLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-Isomenthol
TRC-I821310-250MG 250 mg

(+)-Isomenthol

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561187 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS626835 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
OB Cadherin (CDH11) Rabbit Polyclonal Antibody
AP01246PU-N 100 µg

OB Cadherin (CDH11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccdc58 Mouse Gene Knockout Kit (CRISPR)
KN502725 1 Kit

Ccdc58 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRPS34 Rabbit Polyclonal Antibody
AP21075PU-N 100 µg

MRPS34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details