Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTF3L4 Peptide - C-terminal region

BTF3L4 Peptide - C-terminal region

Product Specifications

UniProt

Q96K17

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTF3L4 Rabbit Polyclonal Antibody (orb586933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689478

Preservative

Lyophilized powder

AA Sequence

SLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enzalutamide Carboxylic Acid
TRC-E559800-25MG 25 mg

Enzalutamide Carboxylic Acid

Sign In for Pricing
View Details
Human SHISA9 activation kit by CRISPRa
GA119035 1 Kit

Human SHISA9 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Ethoxyaniline
TRC-E937758-5G 5 g

3-Ethoxyaniline

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS515612 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Eosinophil Peroxidase (EPO104), 0.2mg/mL
BNUB0104-500 1x 500 µL

Eosinophil Peroxidase (EPO104), 0.2mg/mL

Sign In for Pricing
View Details
ACSM2A (NM_001010845) Human Over-expression Lysate
LC423179 20 µg

ACSM2A (NM_001010845) Human Over-expression Lysate

Sign In for Pricing
View Details