Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF8 Peptide - C-terminal region

C1QTNF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTRP8, UNQ5829

UniProt

P60827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QTNF8 Rabbit Polyclonal Antibody (orb586936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997302

Preservative

Lyophilized powder

AA Sequence

AQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf72 (FOXL2NB) (NM_001040061) Human Over-expression Lysate
LY421664 100 µg

C3orf72 (FOXL2NB) (NM_001040061) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-Human ITGB2 pAb
PA12832-01 50 μL

Rabbit Anti-Human ITGB2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ITGB2 pAb
PA12832-02 100 μL

Rabbit Anti-Human ITGB2 pAb

Sign In for Pricing
View Details
GRP78/Bip Monoclonal Antibody, Cy5 Conjugated
bsm-33224M-Cy5 100 µL

GRP78/Bip Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Human RGS7 Protein Lysate 20ug
IHURGS7PLLY20UG 20 µg

Human RGS7 Protein Lysate 20ug

Sign In for Pricing
View Details
Gpr180 3'UTR GFP Stable Cell Line
TU255360 1.0 mL

Gpr180 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details