Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF8 Peptide - C-terminal region

C1QTNF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTRP8, UNQ5829

UniProt

P60827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QTNF8 Rabbit Polyclonal Antibody (orb586936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997302

Preservative

Lyophilized powder

AA Sequence

AQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human renin polyclonal Antibody
MBS714201-01 0.1 mL

Rabbit anti-human renin polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human renin polyclonal Antibody
MBS714201-02 5x 0.1 mL

Rabbit anti-human renin polyclonal Antibody

Sign In for Pricing
View Details
lacZ Rabbit Polyclonal Antibody
TA396980 10 mg

lacZ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCNH Rabbit Polyclonal Antibody
orb573764 100 µL

CCNH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial
CSB-MP023997HU1a0-01 10 µg

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial
CSB-MP023997HU1a0-02 50 µg

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial

Sign In for Pricing
View Details