C3orf26 Peptide - N-terminal region
C3orf26 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C3orf26
UniProt
Q9BQ75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C3orf26 Rabbit Polyclonal Antibody (orb586937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115735
Preservative
Lyophilized powder
AA Sequence
KTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880460-100 1x 100 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682174-100 1x 100 µL
Cytokeratin 8 (KRT8) (KRT8/2174R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 