Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTI2 Peptide - N-terminal region

TTI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C8orf41

UniProt

Q6NXR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTI2 Rabbit Polyclonal Antibody (orb326714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079391

Preservative

Lyophilized powder

AA Sequence

THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 490)
MBS6308568-01 0.1 mL

HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 490)

Sign In for Pricing
View Details
HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 490)
MBS6308568-02 5x 0.1 mL

HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 490)

Sign In for Pricing
View Details
Lipocalin 1/LCN1 Rabbit Polyclonal Antibody (FITC)
orb467027 100 µL

Lipocalin 1/LCN1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
LPPR5 Antibody
CSB-PA285192-01 50 μL

LPPR5 Antibody

Sign In for Pricing
View Details
LPPR5 Antibody
CSB-PA285192-02 100 µL

LPPR5 Antibody

Sign In for Pricing
View Details
Moesin discontinued
M4305 200 µg

Moesin discontinued

Sign In for Pricing
View Details