LBHD1 Peptide - C-terminal region
LBHD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C11orf48
UniProt
Q9BQE6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LBHD1 Rabbit Polyclonal Antibody (orb326723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_077004
Preservative
Lyophilized powder
AA Sequence
RPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1021003-01 0.02 mg (E-Coli)
Recombinant Caldicellulosiruptor saccharolyticus Probable transcriptional regulatory protein Csac_0964 (Csac_0964)
Sign In for Pricing
View Details MBS1021003-02 0.1 mg (E-Coli)
Recombinant Caldicellulosiruptor saccharolyticus Probable transcriptional regulatory protein Csac_0964 (Csac_0964)
Sign In for Pricing
View Details MBS1021003-03 0.02 mg (Yeast)
Recombinant Caldicellulosiruptor saccharolyticus Probable transcriptional regulatory protein Csac_0964 (Csac_0964)
Sign In for Pricing
View Details MBS1021003-04 0.1 mg (Yeast)
Recombinant Caldicellulosiruptor saccharolyticus Probable transcriptional regulatory protein Csac_0964 (Csac_0964)
Sign In for Pricing
View Details MBS1021003-05 0.02 mg (Baculovirus)
Recombinant Caldicellulosiruptor saccharolyticus Probable transcriptional regulatory protein Csac_0964 (Csac_0964)
Sign In for Pricing
View Details MBS1021003-06 0.02 mg (Mammalian-Cell)
Recombinant Caldicellulosiruptor saccharolyticus Probable transcriptional regulatory protein Csac_0964 (Csac_0964)
Sign In for Pricing
View Details