Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LBHD1 Peptide - C-terminal region

LBHD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C11orf48

UniProt

Q9BQE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LBHD1 Rabbit Polyclonal Antibody (orb326723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077004

Preservative

Lyophilized powder

AA Sequence

RPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHD siRNA Oligos set (Human)
39504171 3x 5 nmol

RHD siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Thyroglobulin Antibody (6E1) [HRP]
NBP2-33096H 0.1 mL

Mouse Monoclonal Thyroglobulin Antibody (6E1) [HRP]

Sign In for Pricing
View Details
Rabggtb Mouse shRNA Lentiviral Particle (Locus ID 19352)
TL501843V 500 µL Each

Rabggtb Mouse shRNA Lentiviral Particle (Locus ID 19352)

Sign In for Pricing
View Details
NCAM-L1 CRISPR Activation Plasmid (h2)
sc-401012-ACT-2 20 µg

NCAM-L1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Rabbit Polyclonal FKRP Antibody
NBP1-69029 100 µL

Rabbit Polyclonal FKRP Antibody

Sign In for Pricing
View Details
PRM3 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06540 0.1 mg

PRM3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details