Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EN2 Peptide - C-terminal region

EN2 Peptide - C-terminal region

Product Specifications

UniProt

P19622

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EN2 Rabbit Polyclonal Antibody (orb329598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001418

Preservative

Lyophilized powder

AA Sequence

NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC2 Antibody
CSB-PA03365A0Rb-01 50 µg

ARPC2 Antibody

Sign In for Pricing
View Details
ARPC2 Antibody
CSB-PA03365A0Rb-02 100 µg

ARPC2 Antibody

Sign In for Pricing
View Details
Recombinant Human LIGHT (N-mFc)
32-11339-50 50 µg

Recombinant Human LIGHT (N-mFc)

Sign In for Pricing
View Details
COPS4 siRNA (Rat)
MBS8211864-01 15 nmol

COPS4 siRNA (Rat)

Sign In for Pricing
View Details
COPS4 siRNA (Rat)
MBS8211864-02 30 nmol

COPS4 siRNA (Rat)

Sign In for Pricing
View Details
COPS4 siRNA (Rat)
MBS8211864-03 5x 30 nmol

COPS4 siRNA (Rat)

Sign In for Pricing
View Details