Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EN2 Peptide - C-terminal region

EN2 Peptide - C-terminal region

Product Specifications

UniProt

P19622

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EN2 Rabbit Polyclonal Antibody (orb329598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001418

Preservative

Lyophilized powder

AA Sequence

NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuroligin-1 Antibody, Clone N97A/31: ATTO 488
SMC-463D-A488 100 µg

Neuroligin-1 Antibody, Clone N97A/31: ATTO 488

Sign In for Pricing
View Details
pExpress-1-Dcaf11 Plasmid
PVT55897 2 µg

pExpress-1-Dcaf11 Plasmid

Sign In for Pricing
View Details
Rabbit Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (029) [FITC]
NBP2-89249F 0.1 mL

Rabbit Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (029) [FITC]

Sign In for Pricing
View Details
NDUFS4 CRISPR/Cas9 KO Plasmid (m)
sc-421844 20 µg

NDUFS4 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
7-Bromo-4H-1,3-benzodioxine
sc-262912 250 mg

7-Bromo-4H-1,3-benzodioxine

Sign In for Pricing
View Details
STX19 Polyclonal Antibody, Biotin Conjugated
A66365-050 50 µL

STX19 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details