Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx8 Peptide - N-terminal region

Lhx8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Lhx7

UniProt

Q5FVG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhx8 Rabbit Polyclonal Antibody (orb573853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012219

Preservative

Lyophilized powder

AA Sequence

MSEECGRPAALAAGRTRKGAGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AM1248 Azepane Isomer
TRC-A729335-100MG 100 mg

AM1248 Azepane Isomer

Sign In for Pricing
View Details
Histone H3 (1-21) -Gly-Gly-Lys (biotinyl) amide TFA
orb3142578-01 50 mg

Histone H3 (1-21) -Gly-Gly-Lys (biotinyl) amide TFA

Sign In for Pricing
View Details
Histone H3 (1-21) -Gly-Gly-Lys (biotinyl) amide TFA
orb3142578-02 10 mg

Histone H3 (1-21) -Gly-Gly-Lys (biotinyl) amide TFA

Sign In for Pricing
View Details
4,4'-Oxybis[p-(phenylsulfonylaniline)] Hydrochloride
TRC-O870561-50MG 50 mg

4,4'-Oxybis[p-(phenylsulfonylaniline)] Hydrochloride

Sign In for Pricing
View Details
IRK8 rabbit pAb
ES9439-01 50 µL

IRK8 rabbit pAb

Sign In for Pricing
View Details
IRK8 rabbit pAb
ES9439-02 100 µL

IRK8 rabbit pAb

Sign In for Pricing
View Details