Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx8 Peptide - N-terminal region

Lhx8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Lhx7

UniProt

Q5FVG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhx8 Rabbit Polyclonal Antibody (orb573853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012219

Preservative

Lyophilized powder

AA Sequence

MSEECGRPAALAAGRTRKGAGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog AngI (Angiotensin I) ELISA Kit
ELK10776-01 48 Tests

Dog AngI (Angiotensin I) ELISA Kit

Sign In for Pricing
View Details
Dog AngI (Angiotensin I) ELISA Kit
ELK10776-02 96 Tests

Dog AngI (Angiotensin I) ELISA Kit

Sign In for Pricing
View Details
Dog AngI (Angiotensin I) ELISA Kit
ELK10776-03 5x 96 Tests

Dog AngI (Angiotensin I) ELISA Kit

Sign In for Pricing
View Details
Free fatty acid receptor 2
orb1641622-01 50 µg

Free fatty acid receptor 2

Sign In for Pricing
View Details
Free fatty acid receptor 2
orb1641622-02 100 µg

Free fatty acid receptor 2

Sign In for Pricing
View Details
Free fatty acid receptor 2
orb1641622-03 1 mg

Free fatty acid receptor 2

Sign In for Pricing
View Details