Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB1I1 Peptide - middle region

TGFB1I1 Peptide - middle region

Product Specifications

Product Name Alternative

ARA55, HIC-5, HIC5, TSC-5

UniProt

B2R8D5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGFB1I1 Rabbit Polyclonal Antibody (orb324475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_057011

Preservative

Lyophilized powder

AA Sequence

PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Perfluorohexyl)ethyl Thiocyanate
TRC-P286330-50MG 50 mg

2-(Perfluorohexyl)ethyl Thiocyanate

Sign In for Pricing
View Details
Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody [Clone ID: OTI6F1]
CF811216 100 µg

Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody [Clone ID: OTI6F1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709550 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (V9), Biotin conjugate, 0.1mg/mL
BNCB2775-100 1x 100 µL

Vimentin (Mesenchymal Cell Marker) (V9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAF4AF1 (KNSTRN) Human Gene Knockout Kit (CRISPR)
KN422981 1 Kit

TRAF4AF1 (KNSTRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR4423 Human qPCR Primer Pair (MI0016760)
HP300948 200 Reactions

MIR4423 Human qPCR Primer Pair (MI0016760)

Sign In for Pricing
View Details