Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB1I1 Peptide - middle region

TGFB1I1 Peptide - middle region

Product Specifications

Product Name Alternative

ARA55, HIC-5, HIC5, TSC-5

UniProt

B2R8D5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGFB1I1 Rabbit Polyclonal Antibody (orb324475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_057011

Preservative

Lyophilized powder

AA Sequence

PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Accuris qMAX Green, qPCR mix with blue tracking dye, No Rox qPCR Mix, 1000 reactions
PR2000-N-1000 1 Each

Accuris qMAX Green, qPCR mix with blue tracking dye, No Rox qPCR Mix, 1000 reactions

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-01 20 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-02 60 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-03 120 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
FHL2 Polyclonal Antibody
E-AB-15037-04 200 µL

FHL2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant RPA70 Antibody
RC-4667-01 50 μL

Recombinant RPA70 Antibody

Sign In for Pricing
View Details