Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbr2 Peptide - N-terminal region

Cbr2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MLCR

UniProt

P08074

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cbr2 Rabbit Polyclonal Antibody (orb325016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031647

Preservative

Lyophilized powder

AA Sequence

VCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRAT Human Over-expression Lysate
orb1346168 100 µg

LRAT Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken Alanine glyoxylate aminotransferase 2 like 1 (AGXT2L1) ELISA Kit
GTR10343336 96 Well

Chicken Alanine glyoxylate aminotransferase 2 like 1 (AGXT2L1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human BCL2 Like 2
7-04536 1 mg

Recombinant Human BCL2 Like 2

Sign In for Pricing
View Details
CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (MaxLight 750) discontinued
034038-ML750 100 µL

CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Protein (C-Avi-His, SARS-CoV-2)
P519156 100 µg

Protein (C-Avi-His, SARS-CoV-2)

Sign In for Pricing
View Details
BST2 peptide
orb216975-01 1 mg

BST2 peptide

Sign In for Pricing
View Details