Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbr2 Peptide - N-terminal region

Cbr2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MLCR

UniProt

P08074

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cbr2 Rabbit Polyclonal Antibody (orb325016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031647

Preservative

Lyophilized powder

AA Sequence

VCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC8A3 Protein Lysate 20ug
IHUSLC8A3PLLY20UG 20 µg

Human SLC8A3 Protein Lysate 20ug

Sign In for Pricing
View Details
MYST1/KAT8 Rabbit Polyclonal Antibody (Biotin)
orb449089 100 µL

MYST1/KAT8 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
C9orf31 sgRNA CRISPR Lentivector set (Human)
K0265701 3x 1.0 µg

C9orf31 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (MaxLight 750) discontinued
C9095-16K1-ML750 100 µL

CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Angiotensin I (AngI) ELISA Kit
MBS2024766-01 24 Strip Well

Mouse Angiotensin I (AngI) ELISA Kit

Sign In for Pricing
View Details
Mouse Angiotensin I (AngI) ELISA Kit
MBS2024766-02 48 Well

Mouse Angiotensin I (AngI) ELISA Kit

Sign In for Pricing
View Details