Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem178 Peptide - N-terminal region

Tmem178 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810417M05Rik

UniProt

Q9CZ16

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem178 Rabbit Polyclonal Antibody (orb325048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080792

Preservative

Lyophilized powder

AA Sequence

PDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRPT2 (CDC73) (NM_024529) Human Over-expression Lysate
LC402998 20 µg

HRPT2 (CDC73) (NM_024529) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Citryl (R)-Phenylephrine (Mixture of Diastereomers)
TRC-C535720-50MG 50 mg

N-Citryl (R)-Phenylephrine (Mixture of Diastereomers)

Sign In for Pricing
View Details
TST (NM_003312) Human Over-expression Lysate
LY418774 100 µg

TST (NM_003312) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn2r14 Mouse Gene Knockout Kit (CRISPR)
KN519140 1 Kit

Vmn2r14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p18 INK4c (CDKN2C) Human Knockdown Lysate
LY300333 100 µg

p18 INK4c (CDKN2C) Human Knockdown Lysate

Sign In for Pricing
View Details
PAPP A2 (PAPPA2) (N-term) Rabbit Polyclonal Antibody
AP31246PU-N 50 µg

PAPP A2 (PAPPA2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details