Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem178 Peptide - N-terminal region

Tmem178 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810417M05Rik

UniProt

Q9CZ16

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem178 Rabbit Polyclonal Antibody (orb325048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080792

Preservative

Lyophilized powder

AA Sequence

PDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF405S conjugate, 0.1mg/mL
BNC042386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UXS 1 (UXS1) Human Gene Knockout Kit (CRISPR)
KN203354RB 1 Kit

UXS 1 (UXS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR561101 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
PTGR1 (NM_001146109) Human Over-expression Lysate
LY431263 100 µg

PTGR1 (NM_001146109) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF640R conjugate, 0.1mg/mL
BNC401623-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Usp21 Mouse Gene Knockout Kit (CRISPR)
KN518780 1 Kit

Usp21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details