Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pex12 Peptide - C-terminal region

Pex12 Peptide - C-terminal region

Product Specifications

UniProt

O88177

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pex12 Rabbit Polyclonal Antibody (orb330268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446373

Preservative

Lyophilized powder

AA Sequence

SVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Stella/Dppa3 Antibody [DyLight 405]
NBP2-41089V 0.1 mL

Rabbit Polyclonal Stella/Dppa3 Antibody [DyLight 405]

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit (vatP)
MBS1013373 Inquire

Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit (vatP)

Sign In for Pricing
View Details
Anti-STAT1 Antibody Picoband®, Dylight550 Conjugate
A00036-3-Dylight550 100 µg

Anti-STAT1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Dlx1 Rabbit Polyclonal Antibody
orb1777-01 50 μL

Dlx1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dlx1 Rabbit Polyclonal Antibody
orb1777-02 100 µL

Dlx1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dlx1 Rabbit Polyclonal Antibody
orb1777-03 200 µL

Dlx1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details