Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pex12 Peptide - C-terminal region

Pex12 Peptide - C-terminal region

Product Specifications

UniProt

O88177

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pex12 Rabbit Polyclonal Antibody (orb330268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446373

Preservative

Lyophilized powder

AA Sequence

SVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VTN Antibody
E91667 100 µL

VTN Antibody

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF594 conjugate, 0.1mg/mL
BNC941082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Jalaric acid
T32254 25 mg

Jalaric acid

Sign In for Pricing
View Details
Human AP-1 complex subunit beta-1, AP1B1 ELISA KIT
ELI-49180h 96 Tests

Human AP-1 complex subunit beta-1, AP1B1 ELISA KIT

Sign In for Pricing
View Details
MTFP1 Polyclonal Antibody
E-AB-67823-01 60 µL

MTFP1 Polyclonal Antibody

Sign In for Pricing
View Details
MTFP1 Polyclonal Antibody
E-AB-67823-02 120 µL

MTFP1 Polyclonal Antibody

Sign In for Pricing
View Details