Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2h Peptide - C-terminal region

Ube2h Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ube2h Rabbit Polyclonal Antibody (orb578686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165598

Preservative

Lyophilized powder

AA Sequence

FESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NDUFS1 Antibody Picoband® FITC Conjugated
A04920-1-FITC 100 µg/Vial

Anti-NDUFS1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
3'-Azido-2',3'-ddGTP
orb1733725 10 ul

3'-Azido-2',3'-ddGTP

Sign In for Pricing
View Details
Anti-SUCLA2 Rabbit pAb
GB112955-50 50 μL

Anti-SUCLA2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Pongo abelii Profilin-2 (PFN2)
MBS1291979-01 0.02 mg (E-Coli)

Recombinant Pongo abelii Profilin-2 (PFN2)

Sign In for Pricing
View Details
Recombinant Pongo abelii Profilin-2 (PFN2)
MBS1291979-02 0.1 mg (E-Coli)

Recombinant Pongo abelii Profilin-2 (PFN2)

Sign In for Pricing
View Details
Recombinant Pongo abelii Profilin-2 (PFN2)
MBS1291979-03 0.02 mg (Yeast)

Recombinant Pongo abelii Profilin-2 (PFN2)

Sign In for Pricing
View Details