Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2h Peptide - C-terminal region

Ube2h Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ube2h Rabbit Polyclonal Antibody (orb578686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165598

Preservative

Lyophilized powder

AA Sequence

FESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Collagen Alpha 1 (XXI) chian (COL21A1) ELISA Kit
GTR10362521 96 Well

Goat Collagen Alpha 1 (XXI) chian (COL21A1) ELISA Kit

Sign In for Pricing
View Details
MAGED1 antibody
FNab04946 100 µg

MAGED1 antibody

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-3/CD33 Antibody (WM53) [Alexa Fluor 405]
NBP2-34511AF405 0.1 mL

Mouse Monoclonal Siglec-3/CD33 Antibody (WM53) [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Chemokine receptor 8 (CCR8)
CSB-CF2709MOV-01 20 µg

Recombinant Macaca fascicularis Chemokine receptor 8 (CCR8)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Chemokine receptor 8 (CCR8)
CSB-CF2709MOV-02 100 µg

Recombinant Macaca fascicularis Chemokine receptor 8 (CCR8)

Sign In for Pricing
View Details
NPL Protein Vector (Human) (pPB-N-His)
PV055630 500 ng

NPL Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details