Mkrn3 Peptide - middle region
Mkrn3 Peptide - middle region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mkrn3 Rabbit Polyclonal Antibody (orb578697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001057262
Preservative
Lyophilized powder
AA Sequence
ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE
More Discoveries
Explore Other Products
Browse additional items from our catalog
36189141 1x 10^6 Cells / 1.0 mL
PCGEM1 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
130129-AP 100 µL
NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (AP) discontinued
Sign In for Pricing
View Details ![[KO Validated] IL6ST Rabbit pAb](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
![[KO Validated] IL6ST Rabbit pAb](https://cdn.genprice.uk/genprice/uk/genprice3.webp)