Mkrn3 Peptide - middle region
Mkrn3 Peptide - middle region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mkrn3 Rabbit Polyclonal Antibody (orb578697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001057262
Preservative
Lyophilized powder
AA Sequence
ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0003602-01 20 µL
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
Sign In for Pricing
View Details 
TRV-0003602-02 100 µL
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
Sign In for Pricing
View Details 
TRV-0003602-03 200 µL
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
Sign In for Pricing
View Details TRV-0003602-04 1 mL
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
Sign In for Pricing
View Details