Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Unkl Peptide - N-terminal region

Unkl Peptide - N-terminal region

Product Specifications

Product Name Alternative

1300004G08Rik

UniProt

B9EKD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Unkl Rabbit Polyclonal Antibody (orb578782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083065

Preservative

Lyophilized powder

AA Sequence

IASLDKDLEEQDLGLTGLNGVPGSIWDFVSGSFSPSPSPILNSGPSASSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PLD4 sgRNA gene knockout kit - Lentiviral human PLD4 sgRNA gene knockout kit (plasmid)
GTR15371153 1 Vial

Lentiviral human PLD4 sgRNA gene knockout kit - Lentiviral human PLD4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
alpha 2b Adrenergic Receptor (ADRA2B) (NM_000682) Human Tagged ORF Clone Lentiviral Particle
RC220659L4V 200 µL

alpha 2b Adrenergic Receptor (ADRA2B) (NM_000682) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
BCAR1 Rabbit Polyclonal Antibody (Cy7)
orb1041929 100 µL

BCAR1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
JTE-952 50mg
A18391-50 50 mg

JTE-952 50mg

Sign In for Pricing
View Details
CHAF1B siRNA (Mouse)
CRN1122-01 15 nmol

CHAF1B siRNA (Mouse)

Sign In for Pricing
View Details
CHAF1B siRNA (Mouse)
CRN1122-02 30 nmol

CHAF1B siRNA (Mouse)

Sign In for Pricing
View Details