Nodal, Mouse
Nodal protein plays a key role in embryonic development and is integral for mesoderm formation and axial patterning. Its involvement in these fundamental processes underscores its importance in coordinating the complex series of events that determine early embryonic morphogenesis. Nodal Protein, Mouse is the recombinant mouse-derived Nodal protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Nodal Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nodal-protein-mouse.html
Purity
97.00
Smiles
HHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL
Molecular Formula
18119 (Gene_ID) P43021 (H245-L354) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
OR56A4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
MOCS3, NT (MOCS3, UBA4, Adenylyltransferase and sulfurtransferase MOCS3, Molybdenum cofactor synthesis protein 3, Molybdopterin synthase sulfurylase, Molybdopterin-synthase adenylyltransferase, Adenylyltransferase MOCS3, Sulfur carrier protein MOCS2A aden
MOCS3, NT (MOCS3, UBA4, Adenylyltransferase and sulfurtransferase MOCS3, Molybdenum cofactor synthesis protein 3, Molybdopterin synthase sulfurylase, Molybdopterin-synthase adenylyltransferase, Adenylyltransferase MOCS3, Sulfur carrier protein MOCS2A aden
