Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a8 Peptide - N-terminal region

Slc9a8 Peptide - N-terminal region

Product Specifications

UniProt

Q4L208

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc9a8 Rabbit Polyclonal Antibody (orb578997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020452

Preservative

Lyophilized powder

AA Sequence

LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TweakR antibody (58A12), IgG1 Chimeric mAb
MBS1882404-01 0.01 mg

Anti-TweakR antibody (58A12), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-TweakR antibody (58A12), IgG1 Chimeric mAb
MBS1882404-02 0.1 mg

Anti-TweakR antibody (58A12), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-TweakR antibody (58A12), IgG1 Chimeric mAb
MBS1882404-03 0.5 mg

Anti-TweakR antibody (58A12), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-TweakR antibody (58A12), IgG1 Chimeric mAb
MBS1882404-04 5x 0.5 mg

Anti-TweakR antibody (58A12), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Fluor 594 Labeling Kit
MBS2571531-01 1 Reaction

Fluor 594 Labeling Kit

Sign In for Pricing
View Details
Fluor 594 Labeling Kit
MBS2571531-02 3 Reactions

Fluor 594 Labeling Kit

Sign In for Pricing
View Details