Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psen2 Peptide - C-terminal region

Psen2 Peptide - C-terminal region

Product Specifications

UniProt

O88777

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psen2 Rabbit Polyclonal Antibody (orb579120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112349

Preservative

Lyophilized powder

AA Sequence

TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USH1C Antibody
KC-1605-01 50 μL

USH1C Antibody

Sign In for Pricing
View Details
USH1C Antibody
KC-1605-02 100 µL

USH1C Antibody

Sign In for Pricing
View Details
USH1C Antibody
KC-1605-03 1 mL

USH1C Antibody

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF594 conjugate, 0.1mg/mL
BNC940046-500 1x 500 µL

Pgp9.5 (UCHL-1) (31A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Livin (BIRC7) activation kit by CRISPRa
GA112446 1 Kit

Human Livin (BIRC7) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Foxl1 activation kit by CRISPRa
GA201441 1 Kit

Mouse Foxl1 activation kit by CRISPRa

Sign In for Pricing
View Details