Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psen2 Peptide - C-terminal region

Psen2 Peptide - C-terminal region

Product Specifications

UniProt

O88777

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psen2 Rabbit Polyclonal Antibody (orb579120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112349

Preservative

Lyophilized powder

AA Sequence

TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sex Hormone Binding Globulin (SHBG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]
TA507184BM 100 µL

Sex Hormone Binding Globulin (SHBG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
TentaGel® MB CHO
MB300006.5G 5 g

TentaGel® MB CHO

Sign In for Pricing
View Details
Turbidity Meter BMET-701
BMET-701 1 Unit

Turbidity Meter BMET-701

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: A53-B/A2.26 + BA17]
AM50256PU-T 20 µg

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: A53-B/A2.26 + BA17]

Sign In for Pricing
View Details
Human ADIPOR1 (Adiponectin Receptor 1) CLIA Kit
E-CL-H0226-01 24 Tests

Human ADIPOR1 (Adiponectin Receptor 1) CLIA Kit

Sign In for Pricing
View Details
Human ADIPOR1 (Adiponectin Receptor 1) CLIA Kit
E-CL-H0226-02 48 Tests

Human ADIPOR1 (Adiponectin Receptor 1) CLIA Kit

Sign In for Pricing
View Details