Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dsg2 Peptide - middle region

Dsg2 Peptide - middle region

Product Specifications

Product Name Alternative

AA408168, D18Ertd293e

UniProt

O55111

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dsg2 Rabbit Polyclonal Antibody (orb579405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031909

Preservative

Lyophilized powder

AA Sequence

TDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVTLVKEVDYEEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Isothiocyanatomethyl) cyclopropane
GAA06890 2.5 g

(Isothiocyanatomethyl) cyclopropane

Sign In for Pricing
View Details
NDUFS1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
31661126 3x 1.0µg DNA

NDUFS1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Hsa-miR-3157-5p miRNA Antagomir
orb1915364-01 10 nmol

Hsa-miR-3157-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-3157-5p miRNA Antagomir
orb1915364-02 20 nmol

Hsa-miR-3157-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse anti-Gamma-aminobutyric acid receptor subunit beta-1 antibody ELISA kit
GTR10404076 96 Well

Mouse anti-Gamma-aminobutyric acid receptor subunit beta-1 antibody ELISA kit

Sign In for Pricing
View Details
FBXO38 Polyclonal Antibody
bs-9122R 100 µL

FBXO38 Polyclonal Antibody

Sign In for Pricing
View Details