Dsg2 Peptide - middle region
Dsg2 Peptide - middle region
Product Specifications
Product Name Alternative
AA408168, D18Ertd293e
UniProt
O55111
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dsg2 Rabbit Polyclonal Antibody (orb579405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031909
Preservative
Lyophilized powder
AA Sequence
TDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVTLVKEVDYEEM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
13448121 3x 1.0µg DNA
BRAF CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
TL706921V 500 µL Each
Ebf2 Rat shRNA Lentiviral Particle (Locus ID 361060)
Sign In for Pricing
View Details 
18817124 3x 1.0µg DNA
E130304F04Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details abx510678 96 Tests
Rat DnaJ (Hsp40) Homolog, Subfamily C, Member 5 Beta (DNAJC5B) ELISA Kit
Sign In for Pricing
View Details 
RC207182L2V 200 µL
ABCB4 (NM_018849) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details