Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St8sia1 Peptide - middle region

St8sia1 Peptide - middle region

Product Specifications

Product Name Alternative

Siat8, Siat8a

UniProt

G3V7T2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with St8sia1 Rabbit Polyclonal Antibody (orb325216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036945

Preservative

Lyophilized powder

AA Sequence

NPNFLRNIGKFWKGRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP1 Protein Lysate (Human) with C-Ha Tag
30361031 100 µg

MPP1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
2310030G06Rik HDR Plasmid (m)
sc-426287-HDR 20 µg

2310030G06Rik HDR Plasmid (m)

Sign In for Pricing
View Details
6-Oxaspiro[2.5]octane-1-carboxylic acid
OR306524-01 100 mg

6-Oxaspiro[2.5]octane-1-carboxylic acid

Sign In for Pricing
View Details
6-Oxaspiro[2.5]octane-1-carboxylic acid
OR306524-02 250 mg

6-Oxaspiro[2.5]octane-1-carboxylic acid

Sign In for Pricing
View Details
6-Oxaspiro[2.5]octane-1-carboxylic acid
OR306524-03 1 g

6-Oxaspiro[2.5]octane-1-carboxylic acid

Sign In for Pricing
View Details
6-Oxaspiro[2.5]octane-1-carboxylic acid
OR306524-04 5 g

6-Oxaspiro[2.5]octane-1-carboxylic acid

Sign In for Pricing
View Details