Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTP1 Peptide - N-terminal region

GSTP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFN7, FAEES3, GST3, GSTP, PI

UniProt

P09211

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTP1 Rabbit Polyclonal Antibody (orb580419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000843

Preservative

Lyophilized powder

AA Sequence

TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4885803 1.0 µg DNA

Eif6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody [Clone ID: 16/SAN27]
TA355341 1 mL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody [Clone ID: 16/SAN27]

Sign In for Pricing
View Details
Podoplanin (B-11) Alexa Fluor® 546
sc-166906 AF546 200 µg/mL

Podoplanin (B-11) Alexa Fluor® 546

Sign In for Pricing
View Details
Serpin Family B Member 2 (SERPINB2) Antibody
abx211585-01 50 µL

Serpin Family B Member 2 (SERPINB2) Antibody

Sign In for Pricing
View Details
Serpin Family B Member 2 (SERPINB2) Antibody
abx211585-02 100 µL

Serpin Family B Member 2 (SERPINB2) Antibody

Sign In for Pricing
View Details
Mouse Gastrokine 1 (GKN1) ELISA Kit-Sandwich
EK5F136-01 48 Test

Mouse Gastrokine 1 (GKN1) ELISA Kit-Sandwich

Sign In for Pricing
View Details