Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppil3 Peptide - C-terminal region

Ppil3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cyp10l

UniProt

Q812D3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppil3 Rabbit Polyclonal Antibody (orb581289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783638

Preservative

Lyophilized powder

AA Sequence

HLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAX1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV747946 1.0 µg DNA

SCAX1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Verdiperstat
BA3441-5.1 1 mL (10 mM in DMSO)

Verdiperstat

Sign In for Pricing
View Details
H IL1RL1 Expression Lentivirus
LVP1168 1x 10^7 IFU/mL - 200 μL

H IL1RL1 Expression Lentivirus

Sign In for Pricing
View Details
C19orf62 Over-expression Lysate Product
GWB-F09FD6 0.1 mg

C19orf62 Over-expression Lysate Product

Sign In for Pricing
View Details
ISO20560PM-220X125-SALPETERZUUR Pipe Markers for Gases
316841 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-220X125-SALPETERZUUR Pipe Markers for Gases

Sign In for Pricing
View Details
Anti-Cdiff Toxin A Reference Antibody (actoxumab)
MBS9247642-01 0.1 mg

Anti-Cdiff Toxin A Reference Antibody (actoxumab)

Sign In for Pricing
View Details